Lineage for d1kamc1 (1kam C:2-188)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2442798Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2442811Species Bacillus subtilis [TaxId:1423] [75164] (2 PDB entries)
  8. 2442814Domain d1kamc1: 1kam C:2-188 [72256]
    Other proteins in same PDB: d1kama2, d1kamb2, d1kamc2, d1kamd2

Details for d1kamc1

PDB Entry: 1kam (more details), 2.1 Å

PDB Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase
PDB Compounds: (C:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d1kamc1:

Sequence, based on SEQRES records: (download)

>d1kamc1 c.26.1.3 (C:2-188) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
kkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfhrvemlk
laiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwyklde
llnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyv
eenglye

Sequence, based on observed residues (ATOM records): (download)

>d1kamc1 c.26.1.3 (C:2-188) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
kkigifggtfdpphnghllmanevlyqagldeiwfmpnqipdsfhrvemlklaiqsnpsf
klelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykldellnliqfig
vkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglye

SCOPe Domain Coordinates for d1kamc1:

Click to download the PDB-style file with coordinates for d1kamc1.
(The format of our PDB-style files is described here.)

Timeline for d1kamc1: