Lineage for d1kama_ (1kam A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) 
Family c.26.1.3: Adenylyltransferase [52397] (3 proteins) 
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (4 species) 
Species Bacillus subtilis [TaxId:1423] [75164] (2 PDB entries) 
Domain d1kama_: 1kam A: [72254]
Details for d1kama_
PDB Entry: 1kam (more details), 2.1 Å
PDB Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase
SCOP Domain Sequences for d1kama_:
Sequence, based on SEQRES records: (download)
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis}
skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfhrveml
klaiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykld
ellnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkky
veenglyes
Sequence, based on observed residues (ATOM records): (download)
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis}
skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipdsfhrvemlklaiqsnps
fklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykldellnliqfi
gvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglyes
SCOP Domain Coordinates for d1kama_:
Click to download the PDB-style file with coordinates for d1kama_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kama_:
- d1kama_ is new in SCOP 1.61
- d1kama_ appears in SCOP 1.63
- d1kama_ appears in the current release, SCOPe 2.08, called d1kama1
View in 3D
