Lineage for d1kaga_ (1kag A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109815Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 protein domains)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 2109816Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 2109827Species Escherichia coli [TaxId:562] [75193] (1 PDB entry)
  8. 2109828Domain d1kaga_: 1kag A: [72249]

Details for d1kaga_

PDB Entry: 1kag (more details), 2.05 Å

PDB Description: Crystal Structure of the Escherichia coli Shikimate Kinase I (AroK)
PDB Compounds: (A:) Shikimate kinase I

SCOPe Domain Sequences for d1kaga_:

Sequence, based on SEQRES records: (download)

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}
ekrniflvgpmgagkstigrqlaqqlnmefydsdqeiekrtgadvgwvfdlegeegfrdr
eekvineltekqgivlatgggsvksretrnrlsargvvvylettiekqlartqrdkkrpl
lhvetpprevlealanernplyeeiadvtirtddqsakvvanqiihmle

Sequence, based on observed residues (ATOM records): (download)

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}
ekrniflvgpmgagkstigrqlaqqlnmefydsdqeiekrtgadvgwvfdlegeegfrdr
eekvineltekqgivlatgggsvksretrnrlsargvvvylettiekqlartpllhvetp
prevlealanernplyeeiadvtisakvvanqiihmle

SCOPe Domain Coordinates for d1kaga_:

Click to download the PDB-style file with coordinates for d1kaga_.
(The format of our PDB-style files is described here.)

Timeline for d1kaga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kagb_