Lineage for d1kaeb_ (1kae B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909016Family c.82.1.2: L-histidinol dehydrogenase HisD [69602] (1 protein)
    automatically mapped to Pfam PF00815
  6. 2909017Protein L-histidinol dehydrogenase HisD [69603] (1 species)
  7. 2909018Species Escherichia coli [TaxId:562] [69604] (4 PDB entries)
  8. 2909022Domain d1kaeb_: 1kae B: [72248]
    complexed with dtt, gol, hso, imd, nad, so4, zn

Details for d1kaeb_

PDB Entry: 1kae (more details), 1.7 Å

PDB Description: l-histidinol dehydrogenase (hisd) structure complexed with l- histidinol (substrate), zinc and nad (cofactor)
PDB Compounds: (B:) Histidinol dehydrogenase

SCOPe Domain Sequences for d1kaeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kaeb_ c.82.1.2 (B:) L-histidinol dehydrogenase HisD {Escherichia coli [TaxId: 562]}
msfntiidwnsctaeqqrqllmrpaisasesitrtvndildnvkargdealreysakfdk
ttvtalkvsaeeiaaaserlsdelkqamavavknietfhtaqklppvdvetqpgvrcqqv
trpvasvglyipggsaplfstvlmlatpasiagckkvvlcspppiadeilyaaqlcgvqd
vfnvggaqaiaalafgtesvpkvdkifgpgnafvteakrqvsqrldgaaidmpagpsevl
viadsgatpdfvasdllsqaehgpdsqvilltpaadmarrvaeaverqlaelpraetarq
alnasrlivtkdlaqcveisnqygpehliiqtrnarelvdsitsagsvflgdwspesagd
yasgtnhvlptygytatcsslgladfqkrmtvqelskegfsalastietlaaaerltahk
navtlrvnalkeqa

SCOPe Domain Coordinates for d1kaeb_:

Click to download the PDB-style file with coordinates for d1kaeb_.
(The format of our PDB-style files is described here.)

Timeline for d1kaeb_: