Lineage for d1ka8f_ (1ka8 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721873Family a.4.5.20: P4 origin-binding domain-like [46856] (2 proteins)
    C-terminus passes through the first loop
  6. 1721877Protein P4 origin-binding domain [74688] (1 species)
  7. 1721878Species Bacteriophage P4 [TaxId:10680] [74689] (1 PDB entry)
  8. 1721884Domain d1ka8f_: 1ka8 F: [72246]

Details for d1ka8f_

PDB Entry: 1ka8 (more details), 2.95 Å

PDB Description: Crystal Structure of the Phage P4 Origin-Binding Domain
PDB Compounds: (F:) putative P4-specific DNA primase

SCOPe Domain Sequences for d1ka8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka8f_ a.4.5.20 (F:) P4 origin-binding domain {Bacteriophage P4 [TaxId: 10680]}
dadptfdfigyletlpqtsgmymgnasiiprnyrkylyhaylaymeangyrnvlslkmfg
lglpvmlkeyglnyekrhtkqgiqtnltlkeesygdwlpk

SCOPe Domain Coordinates for d1ka8f_:

Click to download the PDB-style file with coordinates for d1ka8f_.
(The format of our PDB-style files is described here.)

Timeline for d1ka8f_: