Lineage for d1ka8a_ (1ka8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983111Family a.4.5.20: P4 origin-binding domain-like [46856] (2 proteins)
    C-terminus passes through the first loop
  6. 1983115Protein P4 origin-binding domain [74688] (1 species)
  7. 1983116Species Bacteriophage P4 [TaxId:10680] [74689] (1 PDB entry)
  8. 1983117Domain d1ka8a_: 1ka8 A: [72241]

Details for d1ka8a_

PDB Entry: 1ka8 (more details), 2.95 Å

PDB Description: Crystal Structure of the Phage P4 Origin-Binding Domain
PDB Compounds: (A:) putative P4-specific DNA primase

SCOPe Domain Sequences for d1ka8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ka8a_ a.4.5.20 (A:) P4 origin-binding domain {Bacteriophage P4 [TaxId: 10680]}
dadptfdfigyletlpqtsgmymgnasiiprnyrkylyhaylaymeangyrnvlslkmfg
lglpvmlkeyglnyekrhtkqgiqtnltlkeesygdwlpk

SCOPe Domain Coordinates for d1ka8a_:

Click to download the PDB-style file with coordinates for d1ka8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ka8a_: