Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.20: P4 origin-binding domain-like [46856] (2 proteins) C-terminus passes through the first loop |
Protein P4 origin-binding domain [74688] (1 species) |
Species Bacteriophage P4 [TaxId:10680] [74689] (1 PDB entry) |
Domain d1ka8a_: 1ka8 A: [72241] |
PDB Entry: 1ka8 (more details), 2.95 Å
SCOPe Domain Sequences for d1ka8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ka8a_ a.4.5.20 (A:) P4 origin-binding domain {Bacteriophage P4 [TaxId: 10680]} dadptfdfigyletlpqtsgmymgnasiiprnyrkylyhaylaymeangyrnvlslkmfg lglpvmlkeyglnyekrhtkqgiqtnltlkeesygdwlpk
Timeline for d1ka8a_: