Lineage for d1k9pa_ (1k9p A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914096Protein Calcyclin (S100) [47479] (17 species)
  7. 914209Species Human (Homo sapiens), s100a6 [TaxId:9606] [74719] (4 PDB entries)
  8. 914214Domain d1k9pa_: 1k9p A: [72238]
    complexed with bme

Details for d1k9pa_

PDB Entry: 1k9p (more details), 1.9 Å

PDB Description: crystal structure of calcium free (or apo) human s100a6
PDB Compounds: (A:) s100a6

SCOPe Domain Sequences for d1k9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}
acpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
rnkdqevnfqeyvtflgalaliynealkg

SCOPe Domain Coordinates for d1k9pa_:

Click to download the PDB-style file with coordinates for d1k9pa_.
(The format of our PDB-style files is described here.)

Timeline for d1k9pa_: