![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
![]() | Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) ![]() |
![]() | Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
![]() | Protein Archaeal L30 (L30a) [55133] (1 species) long-chain member of the family; contains additional C-terminal (sub)domain |
![]() | Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries) Uniprot P14121 |
![]() | Domain d1k9mx_: 1k9m X: [72235] Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9my_, d1k9mz_ complexed with cd, cl, k, mg, na, tyk |
PDB Entry: 1k9m (more details), 3 Å
SCOPe Domain Sequences for d1k9mx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9mx_ d.59.1.1 (X:) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d1k9mx_:
![]() Domains from other chains: (mouse over for more information) d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9my_, d1k9mz_ |