Lineage for d1k9mw_ (1k9m W:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904128Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 904129Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 904130Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 904171Species Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
    Uniprot P10971
  8. 904205Domain d1k9mw_: 1k9m W: [72234]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mw_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (W:) ribosomal protein l29

SCOPe Domain Sequences for d1k9mw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mw_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1k9mw_:

Click to download the PDB-style file with coordinates for d1k9mw_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mw_: