Lineage for d1k9mv_ (1k9m V:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750455Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 750456Protein Ribosomal protein L24e [57750] (1 species)
  7. 750457Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
  8. 750471Domain d1k9mv_: 1k9m V: [72233]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mv_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (V:) ribosomal protein l24e

SCOP Domain Sequences for d1k9mv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mv_ g.39.1.6 (V:) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d1k9mv_:

Click to download the PDB-style file with coordinates for d1k9mv_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mv_: