SCOP 1.73: Domain d1k9mv_: 1k9m V:

Lineage for d1k9mv_ (1k9m V:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)

8. Domain d1k9mv_: 1k9m V: [72233]
   Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
   complexed with cd, cl, k, mg, na, tyk

Details for d1k9mv_

PDB Entry: 1k9m, 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (V:) ribosomal protein l24e

SCOP Domain Sequences for d1k9mv_:

Sequence; same for both SEQRES and ATOM records:

>d1k9mv_ g.39.1.6 (V:) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1k9mv_:

• d1k9mv_ first appeared in SCOP 1.61
  
• d1k9mv_ appears in SCOP 1.71
  
• d1k9mv_ appears in SCOP 1.75
  
• d1k9mv_ appears in the current release, SCOPe 2.08