SCOP 1.73: Domain d1k9mt_: 1k9m T:

Lineage for d1k9mt_ (1k9m T:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)

6. Protein Ribosomal protein L23 [54191] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries)

8. Domain d1k9mt_: 1k9m T: [72231]
   Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
   complexed with cd, cl, k, mg, na, tyk

Details for d1k9mt_

PDB Entry: 1k9m, 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (T:) ribosomal protein l23

SCOP Domain Sequences for d1k9mt_:

Sequence; same for both SEQRES and ATOM records:

>d1k9mt_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d1k9mt_:

• d1k9mt_ first appeared in SCOP 1.61
  
• d1k9mt_ appears in SCOP 1.71
  
• d1k9mt_ appears in SCOP 1.75
  
• d1k9mt_ appears in the current release, SCOPe 2.08