![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
![]() | Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) ![]() some topological similarity to prokaryotic ribosomal protein L17 |
![]() | Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
![]() | Protein Ribosomal protein L22 [54845] (2 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (18 PDB entries) |
![]() | Domain d1k9ms_: 1k9m S: [72230] Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ complexed with cd, cl, k, mg, na, tyk |
PDB Entry: 1k9m (more details), 3 Å
SCOP Domain Sequences for d1k9ms_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9ms_ d.55.1.1 (S:) Ribosomal protein L22 {Archaeon Haloarcula marismortui} gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg eqqgrkpramgrasawnspqvdvelileep
Timeline for d1k9ms_:
![]() Domains from other chains: (mouse over for more information) d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ |