Lineage for d1k9ms_ (1k9m S:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328659Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 328660Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 328661Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 328662Protein Ribosomal protein L22 [54845] (2 species)
  7. 328663Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (12 PDB entries)
  8. 328672Domain d1k9ms_: 1k9m S: [72230]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9ms_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9ms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ms_ d.55.1.1 (S:) Ribosomal protein L22 {Archaeon Haloarcula marismortui}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1k9ms_:

Click to download the PDB-style file with coordinates for d1k9ms_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ms_: