Lineage for d1k9ms_ (1k9m S:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191859Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
  4. 191860Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
  5. 191861Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 191862Protein Ribosomal protein L22 [54845] (2 species)
  7. 191863Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (7 PDB entries)
  8. 191867Domain d1k9ms_: 1k9m S: [72230]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_

Details for d1k9ms_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9ms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ms_ d.55.1.1 (S:) Ribosomal protein L22 {Archaeon Haloarcula marismortui}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1k9ms_:

Click to download the PDB-style file with coordinates for d1k9ms_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ms_: