Lineage for d1k9mr_ (1k9m R:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372810Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 372811Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 372812Protein Ribosomal proteins L21e [50108] (1 species)
  7. 372813Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (18 PDB entries)
  8. 372822Domain d1k9mr_: 1k9m R: [72229]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mr_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9mr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mr_ b.34.5.1 (R:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d1k9mr_:

Click to download the PDB-style file with coordinates for d1k9mr_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mr_: