![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein L18 (L18p) [53139] (3 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (19 PDB entries) |
![]() | Domain d1k9mo_: 1k9m O: [72226] Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ complexed with cd, cl, k, mg, na, tyk |
PDB Entry: 1k9m (more details), 3 Å
SCOP Domain Sequences for d1k9mo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9mo_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui} atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll dgdiel
Timeline for d1k9mo_:
![]() Domains from other chains: (mouse over for more information) d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ |