Lineage for d1k9mo_ (1k9m O:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182512Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 182513Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 182514Protein Ribosomal protein L18 (L18p) [53139] (2 species)
  7. 182515Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (7 PDB entries)
  8. 182519Domain d1k9mo_: 1k9m O: [72226]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_

Details for d1k9mo_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9mo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mo_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1k9mo_:

Click to download the PDB-style file with coordinates for d1k9mo_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mo_: