| Class j: Peptides [58231] (120 folds) |
| Fold j.84: Ribosomal protein L10 [64658] (1 superfamily) |
Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) ![]() |
| Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein) |
| Protein Ribosomal protein L10 [64661] (1 species) two alpha-helical segments visible in the crystal structure |
| Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries) Uniprot P15825 |
| Domain d1k9mi_: 1k9m I: [72220] Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ complexed with cd, cl, k, mg, na, tyk |
PDB Entry: 1k9m (more details), 3 Å
SCOPe Domain Sequences for d1k9mi_:
Sequence, based on SEQRES records: (download)
>d1k9mi_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd
>d1k9mi_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd
Timeline for d1k9mi_:
View in 3DDomains from other chains: (mouse over for more information) d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ |