Lineage for d1k9mi_ (1k9m I:)

  1. Root: SCOP 1.67
  2. 434008Class j: Peptides [58231] (111 folds)
  3. 435248Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 435249Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 435250Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 435251Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 435252Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (17 PDB entries)
  8. 435260Domain d1k9mi_: 1k9m I: [72220]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mi_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9mi_:

Sequence, based on SEQRES records: (download)

>d1k9mi_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1k9mi_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1k9mi_:

Click to download the PDB-style file with coordinates for d1k9mi_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mi_: