SCOP 1.63: Domain d1k9mh_: 1k9m H:

Lineage for d1k9mh_ (1k9m H:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Ribosomal protein L7ae [55319] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (8 PDB entries)

8. Domain d1k9mh_: 1k9m H: [72219]
   Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
   complexed with cd, cl, k, mg, na, tyk

Details for d1k9mh_

PDB Entry: 1k9m, 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9mh_:

Sequence; same for both SEQRES and ATOM records:

>d1k9mh_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

Timeline for d1k9mh_:

• d1k9mh_ first appeared in SCOP 1.61
  
• d1k9mh_ appears in SCOP 1.65
  
• d1k9mh_ appears in the current release, SCOPe 2.08