SCOPe 2.05: Domain d1k9mg1: 1k9m G:1-79

Lineage for d1k9mg1 (1k9m G:1-79)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
   Uniprot P14135

8. Domain d1k9mg1: 1k9m G:1-79 [72217]
   Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
   complexed with cd, cl, k, mg, na, tyk

Details for d1k9mg1

PDB Entry: 1k9m, 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (G:) ribosomal protein l6

SCOPe Domain Sequences for d1k9mg1:

Sequence; same for both SEQRES and ATOM records:

>d1k9mg1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

Timeline for d1k9mg1:

• d1k9mg1 first appeared in SCOP 1.61
  
• d1k9mg1 appears in SCOPe 2.04
  
• d1k9mg1 appears in SCOPe 2.06
  
• d1k9mg1 appears in the current release, SCOPe 2.08