Lineage for d1k9mg1 (1k9m G:1-79)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418863Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 418864Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 418865Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 418866Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 418867Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (18 PDB entries)
  8. 418884Domain d1k9mg1: 1k9m G:1-79 [72217]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_

Details for d1k9mg1

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9mg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mg1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1k9mg1:

Click to download the PDB-style file with coordinates for d1k9mg1.
(The format of our PDB-style files is described here.)

Timeline for d1k9mg1: