Lineage for d1k9me_ (1k9m E:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241002Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 241003Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 241004Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 241005Protein Ribosomal protein L4 [52168] (2 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 241006Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (8 PDB entries)
  8. 241011Domain d1k9me_: 1k9m E: [72215]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9me_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9me_ c.22.1.1 (E:) Ribosomal protein L4 {Archaeon Haloarcula marismortui}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOP Domain Coordinates for d1k9me_:

Click to download the PDB-style file with coordinates for d1k9me_.
(The format of our PDB-style files is described here.)

Timeline for d1k9me_: