Class b: All beta proteins [48724] (141 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins) barrel, closed; n=5, S=8 |
Protein N-terminal domain of ribosomal protein L2 [50299] (2 species) incomplete OB-fold lacking the last strand |
Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (18 PDB entries) includes the N-terminal tail |
Domain d1k9mc2: 1k9m C:1-90 [72213] Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ complexed with cd, cl, k, mg, na, tyk |
PDB Entry: 1k9m (more details), 3 Å
SCOP Domain Sequences for d1k9mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9mc2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui} grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef edgdrrlilapegvgvgdelqvgvdaeiap
Timeline for d1k9mc2:
View in 3D Domains from other chains: (mouse over for more information) d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ |