| Class b: All beta proteins [48724] (111 folds) |
| Fold b.40: OB-fold [50198] (8 superfamilies) |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (15 proteins) |
| Protein N-terminal domain of ribosomal protein L2 [50299] (2 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (7 PDB entries) |
| Domain d1k9mc2: 1k9m C:1-90 [72213] Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ |
PDB Entry: 1k9m (more details), 3 Å
SCOP Domain Sequences for d1k9mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9mc2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap
Timeline for d1k9mc2:
View in 3DDomains from other chains: (mouse over for more information) d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ |