Lineage for d1k9m4_ (1k9m 4:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245344Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1245449Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 1245450Protein Ribosomal protein L44e [57837] (1 species)
  7. 1245451Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 1245485Domain d1k9m4_: 1k9m 4: [72211]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9m4_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (4:) ribosomal protein l44e

SCOPe Domain Sequences for d1k9m4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9m4_ g.41.8.3 (4:) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d1k9m4_:

Click to download the PDB-style file with coordinates for d1k9m4_.
(The format of our PDB-style files is described here.)

Timeline for d1k9m4_: