Class a: All alpha proteins [46456] (202 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies) not a true fold |
Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) interrupted alpha-helix |
Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein) |
Protein Ribosomal protein L39e [48664] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (18 PDB entries) |
Domain d1k9m3_: 1k9m 3: [72210] Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ complexed with cd, cl, k, mg, na, tyk |
PDB Entry: 1k9m (more details), 3 Å
SCOP Domain Sequences for d1k9m3_:
Sequence, based on SEQRES records: (download)
>d1k9m3_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui} gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde
>d1k9m3_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui} gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde
Timeline for d1k9m3_:
View in 3D Domains from other chains: (mouse over for more information) d1k9m1_, d1k9m2_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ |