Lineage for d1k9m3_ (1k9m 3:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218208Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)
  4. 218209Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 218210Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 218211Protein Ribosomal protein L39e [48664] (1 species)
  7. 218212Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (8 PDB entries)
  8. 218217Domain d1k9m3_: 1k9m 3: [72210]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9m3_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k9m3_:

Sequence, based on SEQRES records: (download)

>d1k9m3_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1k9m3_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1k9m3_:

Click to download the PDB-style file with coordinates for d1k9m3_.
(The format of our PDB-style files is described here.)

Timeline for d1k9m3_: