Class g: Small proteins [56992] (61 folds) |
Fold g.41: Rubredoxin-like [57769] (10 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (3 families) |
Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) |
Protein Ribosomal protein L37e [57834] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (8 PDB entries) |
Domain d1k9m2_: 1k9m 2: [72209] Other proteins in same PDB: d1k9m1_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ complexed with cd, cl, k, mg, na, tyk |
PDB Entry: 1k9m (more details), 3 Å
SCOP Domain Sequences for d1k9m2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9m2_ g.41.8.2 (2:) Ribosomal protein L37e {Archaeon Haloarcula marismortui} tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1k9m2_:
View in 3D Domains from other chains: (mouse over for more information) d1k9m1_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_ |