SCOPe 2.05: Domain d1k9ka_: 1k9k A:

Lineage for d1k9ka_ (1k9k A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100a6 [TaxId:9606] [74719] (4 PDB entries)

8. Domain d1k9ka_: 1k9k A: [72206]
   complexed with bme, ca

Details for d1k9ka_

PDB Entry: 1k9k, 1.76 Å

PDB Description: crystal structure of calcium bound human s100a6

PDB Compounds: (A:) s100a6

SCOPe Domain Sequences for d1k9ka_:

Sequence; same for both SEQRES and ATOM records:

>d1k9ka_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}
acpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
rnkdqevnfqeyvtflgalaliynealkg

Timeline for d1k9ka_:

• d1k9ka_ first appeared in SCOP 1.61
  
• d1k9ka_ appears in SCOPe 2.04
  
• d1k9ka_ appears in SCOPe 2.06
  
• d1k9ka_ appears in the current release, SCOPe 2.08