Lineage for d1k9ka_ (1k9k A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152453Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 152454Protein Calcyclin (S100) [47479] (13 species)
  7. 152491Species Human (Homo sapiens), s100a6 [TaxId:9606] [74719] (4 PDB entries)
  8. 152494Domain d1k9ka_: 1k9k A: [72206]

Details for d1k9ka_

PDB Entry: 1k9k (more details), 1.76 Å

PDB Description: crystal structure of calcium bound human s100a6

SCOP Domain Sequences for d1k9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ka_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6}
acpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
rnkdqevnfqeyvtflgalaliynealkg

SCOP Domain Coordinates for d1k9ka_:

Click to download the PDB-style file with coordinates for d1k9ka_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ka_: