SCOP 1.65: Domain d1k8ua_: 1k8u A:

Lineage for d1k8ua_ (1k8u A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (16 species)

7. Species Human (Homo sapiens), s100a6 [TaxId:9606] [74719] (4 PDB entries)

8. Domain d1k8ua_: 1k8u A: [72181]
   complexed with mse; mutant

Details for d1k8ua_

PDB Entry: 1k8u, 1.15 Å

PDB Description: crystal structure of calcium-free (or apo) human s100a6; cys3met mutant (selenomethionine derivative)

SCOP Domain Sequences for d1k8ua_:

Sequence; same for both SEQRES and ATOM records:

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6}
ampldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
rnkdqevnfqeyvtflgalaliynealkg

Timeline for d1k8ua_:

• d1k8ua_ first appeared in SCOP 1.61
  
• d1k8ua_ appears in SCOP 1.63
  
• d1k8ua_ appears in SCOP 1.67
  
• d1k8ua_ appears in the current release, SCOPe 2.08