Lineage for d1k8qb_ (1k8q B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134646Family c.69.1.6: Gastric lipase [53506] (1 protein)
  6. 2134647Protein Gastric lipase [53507] (2 species)
  7. 2134648Species Dog (Canis familiaris) [TaxId:9615] [75284] (1 PDB entry)
  8. 2134650Domain d1k8qb_: 1k8q B: [72178]
    complexed with bog, c11, nag

Details for d1k8qb_

PDB Entry: 1k8q (more details), 2.7 Å

PDB Description: crystal structure of dog gastric lipase in complex with a phosphonate inhibitor
PDB Compounds: (B:) Triacylglycerol lipase, gastric

SCOPe Domain Sequences for d1k8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8qb_ c.69.1.6 (B:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}
afgklhptnpevtmnisqmitywgypaeeyevvtedgyilgidripygrknsenigrrpv
aflqhgllasatnwisnlpnnslafiladagydvwlgnsrgntwarrnlyyspdsvefwa
fsfdemakydlpatidfilkktgqdklhyvghsqgttigfiafstnpklakriktfyala
pvatvkytetlinklmlvpsflfklifgnkifyphhffdqflatevcsretvdllcsnal
fiicgfdtmnlnmsrldvylshnpagtsvqnvlhwsqavksgkfqafdwgspvqnmmhyh
qsmppyynltdmhvpiavwnggndlladphdvdlllsklpnliyhrkippynhldfiwam
dapqavyneivsmmgtd

SCOPe Domain Coordinates for d1k8qb_:

Click to download the PDB-style file with coordinates for d1k8qb_.
(The format of our PDB-style files is described here.)

Timeline for d1k8qb_: