SCOPe 2.05: Domain d1k8qa_: 1k8q A:

Lineage for d1k8qa_ (1k8q A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.6: Gastric lipase [53506] (1 protein)

6. Protein Gastric lipase [53507] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [75284] (1 PDB entry)

8. Domain d1k8qa_: 1k8q A: [72177]
   complexed with bog, c11, nag

Details for d1k8qa_

PDB Entry: 1k8q, 2.7 Å

PDB Description: crystal structure of dog gastric lipase in complex with a phosphonate inhibitor

PDB Compounds: (A:) Triacylglycerol lipase, gastric

SCOPe Domain Sequences for d1k8qa_:

Sequence; same for both SEQRES and ATOM records:

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}
afgklhptnpevtmnisqmitywgypaeeyevvtedgyilgidripygrknsenigrrpv
aflqhgllasatnwisnlpnnslafiladagydvwlgnsrgntwarrnlyyspdsvefwa
fsfdemakydlpatidfilkktgqdklhyvghsqgttigfiafstnpklakriktfyala
pvatvkytetlinklmlvpsflfklifgnkifyphhffdqflatevcsretvdllcsnal
fiicgfdtmnlnmsrldvylshnpagtsvqnvlhwsqavksgkfqafdwgspvqnmmhyh
qsmppyynltdmhvpiavwnggndlladphdvdlllsklpnliyhrkippynhldfiwam
dapqavyneivsmmgtd

Timeline for d1k8qa_:

• d1k8qa_ first appeared in SCOP 1.61
  
• d1k8qa_ appears in SCOPe 2.04
  
• d1k8qa_ appears in SCOPe 2.06
  
• d1k8qa_ appears in the current release, SCOPe 2.08