Lineage for d1k8ha_ (1k8h A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172671Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
  4. 172672Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 172673Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 172674Protein Small protein B (SmpB) [74984] (1 species)
  7. 172675Species Aquifex aeolicus [TaxId:63363] [74985] (1 PDB entry)
  8. 172676Domain d1k8ha_: 1k8h A: [72176]

Details for d1k8ha_

PDB Entry: 1k8h (more details)

PDB Description: nmr structure of small protein b (smpb) from aquifex aeolicus

SCOP Domain Sequences for d1k8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ha_ b.111.1.1 (A:) Small protein B (SmpB) {Aquifex aeolicus}
gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
lialakgkklydr

SCOP Domain Coordinates for d1k8ha_:

Click to download the PDB-style file with coordinates for d1k8ha_.
(The format of our PDB-style files is described here.)

Timeline for d1k8ha_: