SCOP 1.67: Domain d1k8cd_: 1k8c D:

Lineage for d1k8cd_ (1k8c D:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (14 proteins)
   Common fold covers whole protein structure

6. Protein Xylose reductase [75058] (1 species)

7. Species Fungi (Candida tenuis) [TaxId:45596] [75059] (3 PDB entries)

8. Domain d1k8cd_: 1k8c D: [72175]
   complexed with nap

Details for d1k8cd_

PDB Entry: 1k8c, 2.1 Å

PDB Description: Crystal structure of dimeric xylose reductase in complex with NADP(H)

SCOP Domain Sequences for d1k8cd_:

Sequence; same for both SEQRES and ATOM records:

>d1k8cd_ c.1.7.1 (D:) Xylose reductase {Fungi (Candida tenuis)}
sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd
tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl
diglrfndpwdwdnipifv

Timeline for d1k8cd_:

• d1k8cd_ first appeared in SCOP 1.61
  
• d1k8cd_ appears in SCOP 1.65
  
• d1k8cd_ appears in SCOP 1.69
  
• d1k8cd_ appears in the current release, SCOPe 2.08