SCOP 1.61: Domain d1k8ay_: 1k8a Y:

Lineage for d1k8ay_ (1k8a Y:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (7 PDB entries)

8. Domain d1k8ay_: 1k8a Y: [72169]
   Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8az_

Details for d1k8ay_

PDB Entry: 1k8a, 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k8ay_:

Sequence; same for both SEQRES and ATOM records:

>d1k8ay_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1k8ay_:

• d1k8ay_ is new in SCOP 1.61
  
• d1k8ay_ appears in SCOP 1.63
  
• d1k8ay_ appears in the current release, SCOPe 2.08