SCOPe 2.01: Domain d1k8ax_: 1k8a X:

Lineage for d1k8ax_ (1k8a X:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
   Uniprot P14121

8. Domain d1k8ax_: 1k8a X: [72168]
   Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ay_, d1k8az_
   complexed with cai, cd, cl, k, mg, na

Details for d1k8ax_

PDB Entry: 1k8a, 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (X:) ribosomal protein l30

SCOPe Domain Sequences for d1k8ax_:

Sequence; same for both SEQRES and ATOM records:

>d1k8ax_ d.59.1.1 (X:) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d1k8ax_:

• d1k8ax_ first appeared in SCOP 1.61
  
• d1k8ax_ appears in SCOP 1.75
  
• d1k8ax_ appears in SCOPe 2.02
  
• d1k8ax_ appears in the current release, SCOPe 2.08