Lineage for d1k8ap_ (1k8a P:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835020Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 1835021Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 1835022Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 1835114Protein Ribosomal protein L18e [52084] (1 species)
  7. 1835115Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 1835151Domain d1k8ap_: 1k8a P: [72160]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8ap_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (P:) ribosomal protein l18e

SCOPe Domain Sequences for d1k8ap_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ap_ c.12.1.1 (P:) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d1k8ap_:

Click to download the PDB-style file with coordinates for d1k8ap_.
(The format of our PDB-style files is described here.)

Timeline for d1k8ap_: