Lineage for d1k8ao_ (1k8a O:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 317197Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 317198Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 317199Protein Ribosomal protein L18 (L18p) [53139] (2 species)
  7. 317200Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (12 PDB entries)
  8. 317211Domain d1k8ao_: 1k8a O: [72159]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8ao_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k8ao_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ao_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1k8ao_:

Click to download the PDB-style file with coordinates for d1k8ao_.
(The format of our PDB-style files is described here.)

Timeline for d1k8ao_: