Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.2: L15e [54193] (1 protein) elaborated with additional structures |
Protein Ribosomal protein L15e [54194] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries) Uniprot P60618 |
Domain d1k8an_: 1k8a N: [72158] Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_ complexed with cai, cd, cl, k, mg, na |
PDB Entry: 1k8a (more details), 3 Å
SCOPe Domain Sequences for d1k8an_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8an_ d.12.1.2 (N:) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]} arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs ekvrpslrvngaka
Timeline for d1k8an_:
View in 3D Domains from other chains: (mouse over for more information) d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_ |