Lineage for d1k8an_ (1k8a N:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325126Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 325127Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 325145Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 325146Protein Ribosomal protein L15e [54194] (1 species)
  7. 325147Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (12 PDB entries)
  8. 325158Domain d1k8an_: 1k8a N: [72158]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8an_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k8an_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8an_ d.12.1.2 (N:) Ribosomal protein L15e {Archaeon Haloarcula marismortui}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOP Domain Coordinates for d1k8an_:

Click to download the PDB-style file with coordinates for d1k8an_.
(The format of our PDB-style files is described here.)

Timeline for d1k8an_: