Lineage for d1k8ai_ (1k8a I:)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900578Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 900579Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 900580Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 900581Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 900582Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 900617Domain d1k8ai_: 1k8a I: [72153]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8ai_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (I:) ribosomal protein l10

SCOP Domain Sequences for d1k8ai_:

Sequence, based on SEQRES records: (download)

>d1k8ai_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1k8ai_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1k8ai_:

Click to download the PDB-style file with coordinates for d1k8ai_.
(The format of our PDB-style files is described here.)

Timeline for d1k8ai_: