SCOPe 2.05: Domain d1k8ah_: 1k8a H:

Lineage for d1k8ah_ (1k8a H:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
   Uniprot P12743

8. Domain d1k8ah_: 1k8a H: [72152]
   Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
   complexed with cai, cd, cl, k, mg, na

Details for d1k8ah_

PDB Entry: 1k8a, 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (H:) ribosomal protein l7ae

SCOPe Domain Sequences for d1k8ah_:

Sequence; same for both SEQRES and ATOM records:

>d1k8ah_ d.79.3.1 (H:) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

Timeline for d1k8ah_:

• d1k8ah_ first appeared in SCOP 1.61
  
• d1k8ah_ appears in SCOPe 2.04
  
• d1k8ah_ appears in SCOPe 2.06
  
• d1k8ah_ appears in the current release, SCOPe 2.08