Lineage for d1k8ah_ (1k8a H:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258900Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 258984Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 258985Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 258997Protein Ribosomal protein L7ae [55319] (1 species)
  7. 258998Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (8 PDB entries)
  8. 259005Domain d1k8ah_: 1k8a H: [72152]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8ah_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k8ah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ah_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1k8ah_:

Click to download the PDB-style file with coordinates for d1k8ah_.
(The format of our PDB-style files is described here.)

Timeline for d1k8ah_: