Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) automatically mapped to Pfam PF00347 |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) Uniprot P14135 |
Domain d1k8ag1: 1k8a G:1-79 [72150] Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_ complexed with cai, cd, cl, k, mg, na |
PDB Entry: 1k8a (more details), 3 Å
SCOPe Domain Sequences for d1k8ag1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8ag1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]} prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms tigtfqshienmfhgvteg
Timeline for d1k8ag1:
View in 3D Domains from other chains: (mouse over for more information) d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_ |