Lineage for d1k8ag1 (1k8a G:1-79)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196967Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
  4. 196968Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 196969Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 196970Protein Ribosomal protein L6 [56055] (2 species)
  7. 196971Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (7 PDB entries)
  8. 196982Domain d1k8ag1: 1k8a G:1-79 [72150]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_

Details for d1k8ag1

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k8ag1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ag1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1k8ag1:

Click to download the PDB-style file with coordinates for d1k8ag1.
(The format of our PDB-style files is described here.)

Timeline for d1k8ag1: