Lineage for d1k8ac2 (1k8a C:1-90)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166908Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (15 proteins)
  6. 166945Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
  7. 166946Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (7 PDB entries)
  8. 166952Domain d1k8ac2: 1k8a C:1-90 [72146]
    Other proteins in same PDB: d1k8a1_, d1k8a2_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_

Details for d1k8ac2

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1k8ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8ac2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

SCOP Domain Coordinates for d1k8ac2:

Click to download the PDB-style file with coordinates for d1k8ac2.
(The format of our PDB-style files is described here.)

Timeline for d1k8ac2: