Lineage for d1k8a2_ (1k8a 2:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751154Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 751155Protein Ribosomal protein L37e [57834] (1 species)
  7. 751156Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
  8. 751175Domain d1k8a2_: 1k8a 2: [72142]
    Other proteins in same PDB: d1k8a1_, d1k8a3_, d1k8a4_, d1k8ac1, d1k8ac2, d1k8ad_, d1k8ae_, d1k8af_, d1k8ag1, d1k8ag2, d1k8ah_, d1k8ai_, d1k8aj_, d1k8ak_, d1k8al_, d1k8am_, d1k8an_, d1k8ao_, d1k8ap_, d1k8aq_, d1k8ar_, d1k8as_, d1k8at_, d1k8au_, d1k8av_, d1k8aw_, d1k8ax_, d1k8ay_, d1k8az_
    complexed with cai, cd, cl, k, mg, na

Details for d1k8a2_

PDB Entry: 1k8a (more details), 3 Å

PDB Description: Co-crystal structure of Carbomycin A bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (2:) ribosomal protein l37e

SCOP Domain Sequences for d1k8a2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8a2_ g.41.8.2 (2:) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOP Domain Coordinates for d1k8a2_:

Click to download the PDB-style file with coordinates for d1k8a2_.
(The format of our PDB-style files is described here.)

Timeline for d1k8a2_: