Lineage for d1k7wd_ (1k7w D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217746Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 217747Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 217748Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 217762Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 217763Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (5 PDB entries)
  8. 217769Domain d1k7wd_: 1k7w D: [72133]
    complexed with as1; mutant

Details for d1k7wd_

PDB Entry: 1k7w (more details), 1.96 Å

PDB Description: crystal structure of s283a duck delta 2 crystallin mutant

SCOP Domain Sequences for d1k7wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7wd_ a.127.1.1 (D:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin}
stdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseews
kgvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisth
llqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrin
vlplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlsk
maedliiystsefgfltlsdafstgaslmpqkknpdslelirskagrvfgrlasilmvlk
glpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlal
ylvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsve
qytalggtakssvttqieqlrelmkkqkeq

SCOP Domain Coordinates for d1k7wd_:

Click to download the PDB-style file with coordinates for d1k7wd_.
(The format of our PDB-style files is described here.)

Timeline for d1k7wd_: